Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN503302 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Adrenergic, Beta, Receptor Kinase 2 (ADRBK2) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-ADRBK2 antibody: synthetic peptide directed towards the N terminal of human ADRBK2
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Chicken/Avian, Zebrafish
- Host
- Rabbit
- Antigen sequence
FCLNEINEAVPQVKFYEEIKEYEKLDNEEDRLCRS
RQIYD AYIMKELLSC- Epitope
- N-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Leukocyte analysis from WHIM syndrome patients reveals a pivotal role for GRK3 in CXCR4 signaling.
Balabanian K, Levoye A, Klemm L, Lagane B, Hermine O, Harriague J, Baleux F, Arenzana-Seisdedos F, Bachelerie F
The Journal of clinical investigation 2008 Mar;118(3):1074-84
The Journal of clinical investigation 2008 Mar;118(3):1074-84
No comments: Submit comment
No validations: Submit validation data