Explore
Validate
LearnH00008227-M02
antibody from Abnova Corporation
Targeting: AKAP17A
721P, CCDC133, CXYorf3, DXYS155E, MGC39904, SFRS17A, XE7, XE7Y
Western blotAntibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [2]
- ELISA [1]
- Immunocytochemistry [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00008227-M02 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00008227-M02, RRID:AB_530237
- Product name
- SFRS17A monoclonal antibody (M02), clone 2G8
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant RP13-297E16.1.
- Antigen sequence
ERLKGMVQNHQFSTLRISKSTMDFIRFEGEVENKS
LVKSFLACLDGKTIKLSGFSDILKVRAAEFKIDFP
TRHDWDSFFRDAKDMNETLPGERPDTIHLEGLPC- Isotype
- IgG
- Antibody clone number
- 2G8
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- SFRS17A monoclonal antibody (M02), clone 2G8 Western Blot analysis of SFRS17A expression in Hela S3 NE ( Cat # L013V3 ).
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of SFRS17A expression in transfected 293T cell line by SFRS17A monoclonal antibody (M02), clone 2G8.Lane 1: SFRS17A transfected lysate(51.5 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged SFRS17A is approximately 0.1ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunofluorescence of monoclonal antibody to SFRS17A on HeLa cell. [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunoperoxidase of monoclonal antibody to SFRS17A on formalin-fixed paraffin-embedded human small Intestine. [antibody concentration 1 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol
