Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN405416 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Arylsulfatase E (ARSE) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-ARSE antibody: synthetic peptide directed towards the middle region of human ARSE
- Description
- Affinity Purified
- Reactivity
- Human
- Host
- Rabbit
- Antigen sequence
KVVHHDPPLLFDLSRDPSETHILTPASEPVFYQVM
ERVQQ AVWEHQRTLS- Epitope
- Middle Region
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Clinical and molecular analysis of arylsulfatase E in patients with brachytelephalangic chondrodysplasia punctata.
Nino M, Matos-Miranda C, Maeda M, Chen L, Allanson J, Armour C, Greene C, Kamaluddeen M, Rita D, Medne L, Zackai E, Mansour S, Superti-Furga A, Lewanda A, Bober M, Rosenbaum K, Braverman N
American journal of medical genetics. Part A 2008 Apr 15;146A(8):997-1008
American journal of medical genetics. Part A 2008 Apr 15;146A(8):997-1008
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Image(s): Western Blotting