HPA027318

antibody from Atlas Antibodies

Targeting: STAR STARD1

Antibody data

Submit

Validation data

Product number: HPA027318 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA027318, RRID:AB_10601574
Product name: Anti-STAR
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: TCVLAGMATDFGNMPEQKGVIRAEHGPTCMVLHPL AGSPSKTKLTWLLSIDLKGWLPKSIINQVLSQTQV DFAN
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

STAR protein structure - HPA027318 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human adrenal gland and pancreas tissues using Anti-STAR antibody. Corresponding STAR RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Independent antibody validation
Main image
Experimental details: Immunohistochemical staining of human adrenal gland, kidney, lymph node and testis using Anti-STAR antibody HPA027318 (A) shows similar protein distribution across tissues to independent antibody HPA023644 (B).
Antibody #2 product nr: HPA023644
Antibody provider: Atlas Antibodies

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human testis shows strong cytoplasmic positivity in Leydig cells.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human adrenal gland shows high expression.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human pancreas shows low expression as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human lymph node using Anti-STAR antibody HPA027318.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human testis using Anti-STAR antibody HPA027318.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human kidney using Anti-STAR antibody HPA027318.
Sample type: HUMAN