Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
- Immunocytochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00008848-M01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00008848-M01, RRID:AB_463929
- Product name
- TSC22D1 monoclonal antibody (M01), clone 1G7
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a full length recombinant TSC22D1.
- Antigen sequence
MKSQWCRPVAMDLGVYQLRHFSISFLSSLLGTENA
SVRLDNSSSGASVVAIDNKIEQAMDLVKSHLMYAV
REEVEVLKEQIKELIEKNSQLEQENNLLKTLASPE
QLAQFQAQLQTGSPPATTQPQGTTQPPAQPASQGS
GPTA- Isotype
- IgG
- Antibody clone number
- 1G7
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of TSC22D1 expression in transfected 293T cell line by TSC22D1 monoclonal antibody (M01), clone 1G7.Lane 1: TSC22D1 transfected lysate(15.7 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged TSC22D1 is approximately 0.03ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunofluorescence of monoclonal antibody to TSC22D1 on HeLa cell. [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol