Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN503125 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Family with Sequence Similarity 176, Member A (FAM176A) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-TMEM166 antibody: synthetic peptide directed towards the N terminal of human TMEM166
- Description
- Affinity Purified
- Reactivity
- Human, Mouse
- Host
- Rabbit
- Antigen sequence
RLPLSHSPEHVEMALLSNILAAYSFVSENPERAAL
YFVSG VCIGLVLTLA- Epitope
- N-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references TMEM166, a novel transmembrane protein, regulates cell autophagy and apoptosis.
Wang L, Yu C, Lu Y, He P, Guo J, Zhang C, Song Q, Ma D, Shi T, Chen Y
Apoptosis : an international journal on programmed cell death 2007 Aug;12(8):1489-502
Apoptosis : an international journal on programmed cell death 2007 Aug;12(8):1489-502
No comments: Submit comment
No validations: Submit validation data