HPA046744

antibody from Atlas Antibodies

Targeting: MYDGF C19orf10, IL-25, IL-27, IL25, IL27, IL27w, R33729_1, SF20

Antibody data

Submit

Validation data

Product number: HPA046744 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA046744, RRID:AB_2679783
Product name: Anti-MYDGF
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: YLYFTQFKAEVRGAEIEYAMAYSKAAFERESDVPL KTEEFEVTKTAVAHRPGAFKAELSKLVIVAKASRT EL
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

MYDGF protein structure - HPA046744 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human prostate and skeletal muscle tissues using HPA046744 antibody. Corresponding MYDGF RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human lymph node shows strong cytoplasmic positivity in non-germinal center cells.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human skeletal muscle shows no positivity in myocytes as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human prostate shows strong cytoplasmic granular positivity in glandular cells.
Sample type: HUMAN