HPA034525

antibody from Atlas Antibodies

Targeting: PTPRO GLEPP1, NPHS6, PTP-oc, PTP-U2, PTPU2

Antibody data

Submit

Validation data

Product number: HPA034525 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA034525, RRID:AB_10669785
Product name: Anti-PTPRO
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: TRVNISYWEGKDFRTMLYKDFFKGKTVFNHWLPGM CYSNITFQLVSEATFNKSTLVEYSGVSHEPKQHRT APYPPQNISVRIVNLNKNNWEEQSGNFPEESFMRS QDTIGKEKLFHFTEETPEIPSGNISSGWP
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

PTPRO protein structure - HPA034525 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human kidney and skeletal muscle tissues using HPA034525 antibody. Corresponding PTPRO RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human kidney shows strong membranous positivity in cells in glomeruli.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex shows very weak cytoplasmic positivity in neuronal cells.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human colon shows moderate cytoplasmic positivity in lymphoid cells.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human skeletal muscle shows no positivity in myocytes as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human pancreas shows no positivity in exocrine glandular cells as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human liver shows no positivity in hepatocytes as expected.
Sample type: HUMAN