HPA007413

antibody from Atlas Antibodies

Targeting: RCOR3 FLJ10876

Antibody data

Submit

Validation data

Product number: HPA007413 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA007413, RRID:AB_1079796
Product name: Anti-RCOR3
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: RSRTSLMDRQARKLANRHNQGDSDDDVEETHPMDG NDSDYDPKKEAKKEGNTEQPVQTSKIGLGRREYQS LQHRHHSQRSKCRPPKGMYLTQEDVVAVSCSPNAA NT
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

RCOR3 protein structure - HPA007413 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Independent antibody validation
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex, liver, testis and thyroid gland using Anti-RCOR3 antibody HPA007413 (A) shows similar protein distribution across tissues to independent antibody HPA071997 (B).
Antibody #2 product nr: HPA071997
Antibody provider: Atlas Antibodies

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex shows strong nuclear positivity in neuronal cells.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human liver using Anti-RCOR3 antibody HPA007413.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex using Anti-RCOR3 antibody HPA007413.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human thyroid gland using Anti-RCOR3 antibody HPA007413.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human testis using Anti-RCOR3 antibody HPA007413.
Sample type: HUMAN