HPA031107

FRYL antibody from Atlas Antibodies
AF4p12, DKFZp686E205, KIAA0826, MOR2
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA031107
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA031107, RRID:AB_10600536
Product name
Anti-FRYL
Provider product page
Atlas Antibodies - HPA031107
Antibody type
Polyclonal
Reactivity
Human, Mouse, Rat
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
AYCKLINQVNTIKNEAEVINMSEELAQLESILKEA
ESASENEEIDISKAAQTTIETAIHSLIETLKNKEF
ISAVAQVKA
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -