PAB22514

FRYL antibody from Abnova Corporation
AF4p12, DKFZp686E205, KIAA0826, MOR2

Antibody data

Product number
PAB22514
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#PAB22514, RRID:AB_10987166
Product name
FRYL polyclonal antibody
Provider product page
Abnova Corporation - PAB22514
Antibody type
Polyclonal
Description
Rabbit polyclonal antibody raised against recombinant FRYL.
Antigen sequence
AYCKLINQVNTIKNEAEVINMSEELAQLESILKEA
ESASENEEIDISKAAQTTIETAIHSLIETLKNKEF
ISAVAQVKA
Isotype
IgG
Storage
Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -