PAB15727

FRYL antibody from Abnova Corporation
AF4p12, DKFZp686E205, KIAA0826, MOR2
No application information provided.

Antibody data

Product number
PAB15727
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#PAB15727, RRID:AB_10677411
Product name
Fryl polyclonal antibody
Provider product page
Abnova Corporation - PAB15727
Antibody type
Polyclonal
Description
Rabbit polyclonal antibody raised against partial recombinant Fryl.
Antigen sequence
MACGLLETLKFGVLELQEHLDTYTTKREAAEQWLD
NCKRTFGANEDIYRMNTNAHELEFCRRLYRLHFQL
LLLFQAYCKLINQVNTIKNEAEVINMSEELAQLEG
ILKEAEAASENEEIDISKAAQTTIETAIHSLIETL
KNKEFVSAVAQVKAFRTLWPNDIFGSCDDDPVQTL
LHIYFHHQTLGQTGSFAVISSNLDMSEANCKLMEL
NLEIRESLRTVQSYPLLAQTKPVGNMTSTGF
Storage
Store at -20°C.Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -