HPA031107

FRYL antibody from MilliporeSigma / Merck KGaA
AF4p12, DKFZp686E205, KIAA0826, MOR2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA031107
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA031107, RRID:AB_10600536
Product name
Anti-FRYL antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA031107
Antibody type
Polyclonal
Antigen
FRY-like recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
AYCKLINQVNTIKNEAEVINMSEELAQLESILKEA
ESASENEEIDISKAAQTTIETAIHSLIETLKNKEF
ISAVAQVKA
Storage
-20C
Provider Type Product Number
- No reagents -