Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA031333 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA031333, RRID:AB_10601561
- Product name
- Anti-ADARB2
- Antibody type
- Polyclonal
- Description
- Affinity purified using the PrEST antigen as affinity ligand
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
ARRTPMPQEFADSISQLVTQKFREVTTDLTPMHAR
HKALAGIVMTKGLDARQAQVVALSSGTKCIS- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references RNA Toxicity from the ALS/FTD C9ORF72 Expansion Is Mitigated by Antisense Intervention
Donnelly C, Zhang P, Pham J, Haeusler A, Mistry N, Vidensky S, Daley E, Poth E, Hoover B, Fines D, Maragakis N, Tienari P, Petrucelli L, Traynor B, Wang J, Rigo F, Bennett C, Blackshaw S, Sattler R, Rothstein J
Neuron 2013;80(2):415-428
Neuron 2013;80(2):415-428
No comments: Submit comment
No validations: Submit validation data