HPA036527

antibody from Atlas Antibodies

Targeting: SCFD2 FLJ39514, STXBP1L1

Antibody data

Submit

Validation data

Product number: HPA036527 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA036527, RRID:AB_2675175
Product name: Anti-SCFD2
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: ALAQVFCEESGLSPLLQKITDWDSSINLTFHKSKI AVDELFTSLRDIAGARSLLKQFKSVYVPGNHTHQA SYKPLLKQVVEEIFHPERPDSVDIEH
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

SCFD2 protein structure - HPA036527 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Independent antibody validation
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex, cervix, uterine, kidney and testis using Anti-SCFD2 antibody HPA036527 (A) shows similar protein distribution across tissues to independent antibody HPA036526 (B).
Antibody #2 product nr: HPA036526
Antibody provider: Atlas Antibodies

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex shows strong cytoplasmic positivity in neuronal cells.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human testis shows weak cytoplasmic positivity in cells in seminiferous ducts.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human kidney shows weak to moderate cytoplasmic positivity in cells in tubules.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex shows strong granular cytoplasmic positivity in neurons.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human cervix, uterine shows weak cytoplasmic positivity in squamous epithelial cells.
Sample type: HUMAN