HPA053549

antibody from Atlas Antibodies

Targeting: ZG16B HRPE773, JCLN2, PRO1567

Antibody data

Submit

Validation data

Product number: HPA053549 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA053549, RRID:AB_2682184
Product name: Anti-ZG16B
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: AFLRGMVMYTSKDRYFYFGKLDGQISSAYPSQEGQ VLVGIYGQYQLLGIKSIGFEWNYPLEEPTTEPPVN LTYSANSPVG
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

ZG16B protein structure - HPA053549 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human salivary gland and colon tissues using Anti-ZG16B antibody. Corresponding ZG16B RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Independent antibody validation
Main image
Experimental details: Immunohistochemical staining of human colon, liver, salivary gland and testis using Anti-ZG16B antibody HPA053549 (A) shows similar protein distribution across tissues to independent antibody HPA041125 (B).
Antibody #2 product nr: HPA041125
Antibody provider: Atlas Antibodies

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human salivary gland shows high expression.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human colon shows low expression as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human liver using Anti-ZG16B antibody HPA053549.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human testis using Anti-ZG16B antibody HPA053549.
Sample type: HUMAN