Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- PAB22887 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#PAB22887, RRID:AB_10962592
- Product name
- SLCO1C1 polyclonal antibody
- Antibody type
- Polyclonal
- Antigen
- Recombinant protein corresponding to amino acids of human SLCO1C1.
- Reactivity
- Human
- Host
- Rabbit
- Antigen sequence
FITKRERTMVSTRFQKENYTTSDHLLQPNYWPGKE
TQL- Isotype
- IgG
- Vial size
- 100 uL
- Storage
- Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
No validations: Submit validation data