Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN1449881 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Adaptor-Related Protein Complex 3, mu 2 Subunit (AP3M2) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- Synthetic peptide directed towards the middle region of human AP3M2
- Description
- Purified using immunoaffinity column
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Chicken/Avian, Xenopus, Zebrafish
- Host
- Rabbit
- Antigen sequence
VVNTITGSTNVGDQLPTGQLSVVPWRRTGVKYTNN
EAYFDVIEEIDAIID- Epitope
- Middle Region
- Vial size
- 50 μg
- Storage
- Store lyophilized at 2-8°C for one month or at -20°C long term. After reconstitution store the antibody undiluted at 2-8°C for up to one month or in aliquots at -20°C long term.
- Handling
- Avoid repeated freezing and thawing.
Submitted references Mutation screening of AP3M2 in Japanese epilepsy patients.
Huang MC, Okada M, Nakatsu F, Oguni H, Ito M, Morita K, Nagafuji H, Hirose S, Sakaki Y, Kaneko S, Ohno H, Kojima T
Brain & development 2007 Sep;29(8):462-7
Brain & development 2007 Sep;29(8):462-7
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Human HepG2; WB Suggested Anti-AP3M2 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:1562500. Positive Control: HepG2 cell lysate; AP3M2 antibody - middle region (AP44887PU-N) in Human HepG2 cells using Western Blot