H00008566-A01
antibody from Abnova Corporation
Targeting: PDXK
C21orf124, C21orf97, FLJ21324, FLJ31940, MGC15873, PKH, PNK, PRED79
Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00008566-A01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00008566-A01, RRID:AB_627503
- Product name
- PDXK polyclonal antibody (A01)
- Antibody type
- Polyclonal
- Description
- Mouse polyclonal antibody raised against a partial recombinant PDXK.
- Antigen sequence
HWKGQVLNSDELQELYEGLRLNNMNKYDYVLTGYT
RDKSFLAMVVDIVQELKQQNPRLVYVCDPVLGDKW
DGEGSMYVPEDLLPVYKEKVVPLADIITPNQFEAE
LLSGR- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Long-term prednisolone treatments increase bioactive vitamin B6 synthesis in vivo.
Chang HY, Tzen JT, Lin SJ, Wu YT, Chiang EP
The Journal of pharmacology and experimental therapeutics 2011 Apr;337(1):102-9
The Journal of pharmacology and experimental therapeutics 2011 Apr;337(1):102-9
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- PDXK polyclonal antibody (A01), Lot # 061103JCS1 Western Blot analysis of PDXK expression in HeLa ( Cat # L013V1 ).