Antibody data
- Antibody Data
- Antigen structure
- References [3]
- Comments [0]
- Validations
- Western blot [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA035895 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA035895, RRID:AB_10669660
- Product name
- Anti-PAICS
- Antibody type
- Polyclonal
- Reactivity
- Human, Mouse, Rat
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
ETAFIAPQCEMIPIEWVCRRIATGSFLKRNPGVKE
GYKFYPPKVELFFKDDANNDPQWSEEQLIAAKFCF
AGLLIGQTEVDIMS- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Myc-dependent purine biosynthesis affects nucleolar stress and therapy response in prostate cancer
Transiently transfected purine biosynthetic enzymes form stress bodies.
Genetic and metabolomic analysis of AdeD and AdeI mutants of de novo purine biosynthesis: cellular models of de novo purine biosynthesis deficiency disorders.
Barfeld S, Fazli L, Persson M, Marjavaara L, Urbanucci A, Kaukoniemi K, Rennie P, Ceder Y, Chabes A, Visakorpi T, Mills I
Oncotarget 2015 May;6(14):12587-12602
Oncotarget 2015 May;6(14):12587-12602
Transiently transfected purine biosynthetic enzymes form stress bodies.
Zhao A, Tsechansky M, Swaminathan J, Cook L, Ellington AD, Marcotte EM
PloS one 2013;8(2):e56203
PloS one 2013;8(2):e56203
Genetic and metabolomic analysis of AdeD and AdeI mutants of de novo purine biosynthesis: cellular models of de novo purine biosynthesis deficiency disorders.
Duval N, Luhrs K, Wilkinson TG 2nd, Baresova V, Skopova V, Kmoch S, Vacano GN, Zikanova M, Patterson D
Molecular genetics and metabolism 2013 Mar;108(3):178-189
Molecular genetics and metabolism 2013 Mar;108(3):178-189
No comments: Submit comment
Enhanced validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Independent antibody validation
- Main image
- Experimental details
- Western blot analysis using Anti-PAICS antibody HPA035895 (A) shows similar pattern to independent antibody HPA041538 (B).
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human colon shows strong cytoplasmic positivity in glandular cells.
- Sample type
- HUMAN