HPA034621

antibody from Atlas Antibodies

Targeting: SRP72

Western blot

Antibody data

Submit

Validation data

Product number: HPA034621 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA034621, RRID:AB_10601593
Product name: Anti-SRP72
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: ENALKTIESANQQTDKLKELYGQVLYRLERYDECL AVYRDLVRNSQDDYDEERKTNLSAVVAAQSNWEKV VPENLGLQEGTHELCYNTACA
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

SRP72 protein structure - HPA034621 shown in red.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human pancreas shows strong cytoplasmic positivity in exocrine pancreas.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human bone marrow shows moderate cytoplasmic positivity in hematopoietic cells.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human skeletal muscle shows weak cytoplasmic positivity in myocytes.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human tonsil shows moderate to strong cytoplasmic positivity in non-germinal center cells.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human prostate shows moderate positivity in cytoplasm granular in glandular cells.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human placenta shows moderate cytoplasmic positivity in trophoblastic cells.
Sample type: HUMAN