Explore
Validate
Learn
Western blotAntibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [3]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00007109-M01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00007109-M01, RRID:AB_566240
- Product name
- TMEM1 monoclonal antibody (M01), clone 5B4
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant TMEM1.
- Antigen sequence
VRLFKYLPHHSAHSSQLDADSWIENDSLSVDKHGD
DQPDSSSLKSRGSVHSACSSEHKGLPMPRLQALPA
GQVFNSSSGTQVLVIPSQDDHVLEVS- Isotype
- IgG
- Antibody clone number
- 5B4
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references TRAPPC9 mediates the interaction between p150 and COPII vesicles at the target membrane.
Zong M, Satoh A, Yu MK, Siu KY, Ng WY, Chan HC, Tanner JA, Yu S
PloS one 2012;7(1):e29995
PloS one 2012;7(1):e29995
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- TMEM1 monoclonal antibody (M01), clone 5B4 Western Blot analysis of TMEM1 expression in Hela S3 NE ( Cat # L013V3 ).
- Protocol
- Protocol
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of TMEM1 expression in transfected 293T cell line by TMEM1 monoclonal antibody (M01), clone 5B4.Lane 1: TMEM1 transfected lysate(142.2 KDa).Lane 2: Non-transfected lysate.
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- TMEM1 monoclonal antibody (M01), clone 5B4. Western Blot analysis of TRAPPC10 expression in Jurkat.
