HPA039734

VPS36 antibody from Atlas Antibodies
C13orf9, CGI-145, Eap45

Antibody data

Product number
HPA039734
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA039734, RRID:AB_2676652
Product name
Anti-VPS36
Provider product page
Atlas Antibodies - HPA039734
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
AGIGKSAKIVVHLHPAPPNKEPGPFQSSKNSYIKL
SFKEHGQIEFYRRLSEEMTQRRWENMPVSQSLQTN
RG
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.