Explore
Validate
Learn
Western blotAntibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [2]
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00003845-M02 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00003845-M02, RRID:AB_606488
- Product name
- KRAS monoclonal antibody (M02), clone 4F3
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant KRAS.
- Antigen sequence
KSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGET
CLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAIN
NTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDL
PSRTV- Isotype
- IgG
- Antibody clone number
- 4F3
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Synergistic effects of combined Wnt/KRAS inhibition in colorectal cancer cells.
Mologni L, Brussolo S, Ceccon M, Gambacorti-Passerini C
PloS one 2012;7(12):e51449
PloS one 2012;7(12):e51449
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- KRAS monoclonal antibody (M02), clone 4F3 Western Blot analysis of KRAS expression in HeLa ( Cat # L013V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of KRAS expression in transfected 293T cell line by KRAS monoclonal antibody (M02), clone 4F3.Lane 1: KRAS transfected lysate(21 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged KRAS is approximately 0.3ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
