HPA012759

antibody from Atlas Antibodies

Targeting: NECTIN2 CD112, HVEB, PRR2, PVRL2, PVRR2

Antibody data

Submit

Validation data

Product number: HPA012759 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA012759, RRID:AB_1846227
Product name: Anti-NECTIN2
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: VRVQVLPEVRGQLGGTVELPCHLLPPVPGLYISLV TWQRPDAPANHQNVAAFHPKMGPSFPSPKPGSERL SFVSAKQSTGQDTEAELQDATLALHGLTVEDEGNY TCEFATFPKGSVRGMTWLR
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

NECTIN2 protein structure - HPA012759 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human placenta and cerebral cortex tissues using HPA012759 antibody. Corresponding NECTIN2 RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human testis shows cytoplasmic and membranous positivity in cells in seminiferus ducts.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human placenta shows moderate membranous positivity in trophoblastic cells.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human testis shows strong membranous positivity in cells in seminiferous ducts.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human liver shows moderate membranous positivity in hepatocytes.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex shows no positivity in neurons as expected.
Sample type: HUMAN