H00010562-M

OLFM4 antibody from Abnova Corporation
GC1, GW112, OlfD
No application information provided.

Antibody data

Product number
H00010562-M
Provider
Abnova Corporation
Product name
OLFM4 mouse monoclonal antibody (hybridoma)
Provider product page
Abnova Corporation - H00010562-M
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a full-length recombinant OLFM4.
Antigen sequence
MRPGLSFLLALLFFLGQAAGDLGDVGPPIPSPGFS
SFPGVDSSSSFSSSSRSGSSSSRSLGSGGSVSQLF
SNFTGSVDDRGTCQCSVSLPDTTFPVDRVERLEFT
AHVLSQKFEKELSKVREYVQLISVYEKKLLNLTVR
IDIMEKDTISYTELDFELIKVEVKEMEKLVIQLKE
SFGGSSEIVDQLEVEIRNMTLLVEKLETLDKNNVL
AIRREIVALKTKLKECEASKDQNTPVVHPPPTPGS
CGHGGVVNISKPSVVQLNWRGFSYLYGAWGRDYSP
QHPNKGLYWVAPLNTDGRLLEYYRLYNTLDDLLLY
INARELRITYGQGSGTAVYNNNMYVNMYNTGNIAR
VNLTTNTIAVTQTLPNAAYNNRFSYANVAWQDIDF
AVDENGLWVIYSTEASTGNMVISKLNDTTLQVLNT
WYTKQYKPSASNAFMVCGVLYATRTMNTRTEEIFY
YYDTNTGKEGKLDIVMHKMQEKVQSINYNPFDQKL
YVYNDGYLLNYDLSVLQKPQ
Provider Type Product Number
- No reagents -