HPA077718

OLFM4 antibody from Atlas Antibodies
GC1, GW112, OlfD

Antibody data

Product number
HPA077718
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA077718, RRID:AB_2732358
Product name
Anti-OLFM4
Provider product page
Atlas Antibodies - HPA077718
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
KLVIQLKESFGGSSEIVDQLEVEIRNMTLLVEKLE
TLDKNNVLAIRREIVALKTKLKECEASKDQNTPVV
HPPPTPGSCGHGGVVN
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -