HPA009128

antibody from Atlas Antibodies

Targeting: CYP2E1 CYP2E

Western blot

Antibody data

Submit

Validation data

Product number: HPA009128 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA009128, RRID:AB_1078613
Product name: Anti-CYP2E1
Antibody type: Polyclonal
Reactivity: Human, Mouse, Rat
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: EKLHEEIDRVIGPSRIPAIKDRQEMPYMDAVVHEI QRFITLVPSNLPHEATRDTIFRGYLIPKGTVVVPT LDSVLYDNQEFPDPEKFKPEHFLNENGKFKYSDYF KPFSTGKRVCAG
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

CYP2E1 protein structure - HPA009128 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human liver and endometrium tissues using HPA009128 antibody. Corresponding CYP2E1 RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Independent antibody validation
Main image
Experimental details: Immunohistochemical staining of human endometrium, liver, liver cancer and tonsil using Anti-CYP2E1 antibody HPA009128 (A) shows similar protein distribution across tissues to independent antibody HPA029564 (B).
Antibody #2 product nr: HPA029564
Antibody provider: Atlas Antibodies

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human liver shows moderate to strong cytoplasmic positivity in hepatocytes.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human liver cancer (hepatocellular carcinoma) shows moderate cytoplasmic positivity in tumor cells.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human endometrium shows no positivity in glandular or stromal cells as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human liver shows strong cytoplasmic positivity in hepatocytes.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human tonsil shows no positivity in germinal center cells as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human liver cancer shows moderate cytoplasmic positivity in tumor cells.
Sample type: HUMAN