Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- Immunocytochemistry [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00064582-M01 - Provider product page
- Provider
- Abnova Corporation
- Product name
- GPR135 monoclonal antibody (M01), clone 1H5
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant GPR135.
- Antigen sequence
NPNISMLLGRNREEGYRTRNVDAFLPSQGPGLQAR
SRSRLRNRYANRLGACNRMSSSNPASGVAGDVAMW
ARKNPVVLFCREGPPEPVTAVTKQPKSEAGDTS- Isotype
- IgG
- Antibody clone number
- 1H5
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- GPR135 monoclonal antibody (M01), clone 1H5 Western Blot analysis of GPR135 expression in MCF-7 ( Cat # L046V1 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunofluorescence of monoclonal antibody to GPR135 on MCF-7 cell . [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunoperoxidase of monoclonal antibody to GPR135 on formalin-fixed paraffin-embedded human cerebral cortex. [antibody concentration 1.5 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol