HPA055623

antibody from Atlas Antibodies

Targeting: SLC28A2 CNT2, HCNT2, HsT17153, SPNT1

Antibody data

Submit

Validation data

Product number: HPA055623 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA055623, RRID:AB_2682866
Product name: Anti-SLC28A2
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: GAEADCVSFPNTSFTNRTYETYMCCRGLFQSTSLN GTNPPSFSGPWEDKEFSAMALTNCCGFYNNTVCA
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

SLC28A2 protein structure - HPA055623 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human duodenum and liver tissues using Anti-SLC28A2 antibody. Corresponding SLC28A2 RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Independent antibody validation
Main image
Experimental details: Immunohistochemical staining of human colon, liver, lymph node and small intestine using Anti-SLC28A2 antibody HPA055623 (A) shows similar protein distribution across tissues to independent antibody HPA046068 (B).
Antibody #2 product nr: HPA046068
Antibody provider: Atlas Antibodies

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human duodenum shows high expression.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human liver shows low expression as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human colon using Anti-SLC28A2 antibody HPA055623.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human small intestine using Anti-SLC28A2 antibody HPA055623.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human lymph node using Anti-SLC28A2 antibody HPA055623.
Sample type: HUMAN