Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [2]
- ELISA [1]
- Immunocytochemistry [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00023597-M01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00023597-M01, RRID:AB_464211
- Product name
- ACATE2 monoclonal antibody (M01), clone 4E4
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a full length recombinant ACATE2.
- Antigen sequence
MRRAALRLCALGKGQLTPGRGLTQGPQNPKKQGIF
HIHEVRDKLREIVGASTNWRDHVKAMEERKLLHSF
LAKSQDGLPPRRMKDSYIEVLLPLGSEPELREKYL
TVQNTVRFGRILEDLDSLGVLICYMHNKIHSAKMS
PLSIVTALVDKIDMCKKSLSPEQDIKFSGHVSWVG
KTSMEVKMQMFQLHGDEFCPVLDATFVMVARDSEN
KG- Isotype
- IgG
- Antibody clone number
- 4E4
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Proteomic analysis of left ventricular remodeling in an experimental model of heart failure.
Cieniewski-Bernard C, Mulder P, Henry JP, Drobecq H, Dubois E, Pottiez G, Thuillez C, Amouyel P, Richard V, Pinet F
Journal of proteome research 2008 Nov;7(11):5004-16
Journal of proteome research 2008 Nov;7(11):5004-16
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- ACATE2 monoclonal antibody (M01), clone 4E4 Western Blot analysis of ACATE2 expression in MCF-7 ( Cat # L046V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of ACOT9 expression in transfected 293T cell line by ACATE2 monoclonal antibody (M01), clone 4E4.Lane 1: ACOT9 transfected lysate(24 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged ACOT9 is approximately 3ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunofluorescence of monoclonal antibody to ACOT9 on HeLa cell. [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunoperoxidase of monoclonal antibody to ACOT9 on formalin-fixed paraffin-embedded human heart. [antibody concentration 3 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol