HPA021945

antibody from Atlas Antibodies

Targeting: DYSF FER1L1, LGMD2B

Antibody data

Submit

Validation data

Product number: HPA021945 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA021945, RRID:AB_1847928
Product name: Anti-DYSF
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: CHYYYLPWGNVKPVVVLSSYWEDISHRIETQNQLL GIADRLEAGLEQVHLALKAQCSTEDVDSLVAQLTD ELIAGCSQPLGDIHETPSATHLDQYLYQLRTHHLS QITEAALALKLGHSELPAALEQAEDWLLRLRALA
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

DYSF protein structure - HPA021945 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human skeletal muscle and skin tissues using HPA021945 antibody. Corresponding DYSF RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Independent antibody validation
Main image
Experimental details: Immunohistochemical staining of human kidney, skeletal muscle, skin and testis using Anti-DYSF antibody HPA021945 (A) shows similar protein distribution across tissues to independent antibody HPA017071 (B).
Antibody #2 product nr: HPA017071
Antibody provider: Atlas Antibodies

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human skeletal muscle shows high expression.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human skin shows low expression as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human testis using Anti-DYSF antibody HPA021945.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human kidney using Anti-DYSF antibody HPA021945.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human skin shows no positivity in squamous epithelial cells as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human skeletal muscle shows moderate cytoplasmic and membranous positivity in myocytes.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human kidney shows moderate to strong membranous positivity in cells in glomeruli and cells in tubules.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human testis shows moderate membranous positivity in cells in seminiferous ducts.
Sample type: HUMAN