Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN502635 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Dysferlin, Limb Girdle Muscular Dystrophy 2B (Autosomal Recessive) (DYSF) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-DYSF antibody: synthetic peptide directed towards the middle region of human DYSF
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine
- Host
- Rabbit
- Antigen sequence
SRILDESEDTDLPYPPPQREANIYMVPQNIKPALQ
RTAIE ILAWGLRNMK- Epitope
- Middle Region
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Commentary from the editor.
Dysferlinopathy in the Jews of the Caucasus: a frequent mutation in the dysferlin gene.
Dubowitz V
Neuromuscular disorders : NMD 2007 Jan;17(1):1-5
Neuromuscular disorders : NMD 2007 Jan;17(1):1-5
Dysferlinopathy in the Jews of the Caucasus: a frequent mutation in the dysferlin gene.
Leshinsky-Silver E, Argov Z, Rozenboim L, Cohen S, Tzofi Z, Cohen Y, Wirguin Y, Dabby R, Lev D, Sadeh M
Neuromuscular disorders : NMD 2007 Dec;17(11-12):950-4
Neuromuscular disorders : NMD 2007 Dec;17(11-12):950-4
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Image(s): Western Blotting