HPA041799

antibody from Atlas Antibodies

Targeting: NUBP1 CIAO5, NBP1, NBP35

Antibody data

Submit

Validation data

Product number: HPA041799 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA041799, RRID:AB_10960692
Product name: Anti-NUBP1
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: MSGFICPKCKKESQIFPPTTGGAELMCQDLEVPLL GRVPLDPLIGKNCDKGQSFFIDAPDSPATLAYRSI IQRIQEFCNLHQSKEENLISS
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

NUBP1 protein structure - HPA041799 shown in red.

Enhanced validation

Submitted by: klas2
Enhanced method: Genetic validation
Main image
Experimental details: Western blot of cell lysate from U-2 OS cells transfected with either siRNA targeting NUBP1 or control siRNA. Lane 1: Marker (250, 130, 95, 72, 55, 36, 28, 17, 10) Lane 2: Cell lysate from U-2OS cells transfected with siRNA targeting NUBP1 Lane 3: N/A Lane 4: Cell lysate from U-2OS cells transfected with control siRNA Right image, lane 1-4: loading control
Sample type: U-2 OS
Primary Ab dilution: 1:278
Conjugate: Horseradish Peroxidase
Secondary Ab: Secondary Ab
Secondary Ab dilution: 1:3000
Knockdown/Genetic Approaches Application: Western blot
KD Reagent Type: siRNA
Downregulation: >75%
KD Reagent Prod no: s9289
KD Reagent Prod page: KD Reagent Prod page
KD Reagent Provider: Thermo Fisher Scientific
KD Reagent Page 2: KD Reagent Page 2
KD Reagent Prod no 2: s9290
KD Reagent Prod no 3: s9288
KD Reagent Page 3: KD Reagent Page 3
Antibody Lot Number: R38274
Appendix: 566d8b5e1450a.pdf

Supportive validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Genetic validation
Main image
Experimental details: Western blot analysis in U2OS cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-NUBP1 antibody. Remaining relative intensity is presented.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Independent antibody validation
Main image
Experimental details: Western blot analysis using Anti-NUBP1 antibody HPA041799 (A) shows similar pattern to independent antibody HPA041656 (B).
Antibody #2 product nr: HPA041656
Antibody provider: Atlas Antibodies

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Human cell line RT-4Lane 3: Human cell line U-251MG spLane 4: Human plasma (IgG/HSA depleted)Lane 5: Human liver tissueLane 6: Human tonsil tissue

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Independent antibody validation
Main image
Experimental details: Immunohistochemical staining of human colon, kidney, liver and testis using Anti-NUBP1 antibody HPA041799 (A) shows similar protein distribution across tissues to independent antibody HPA041656 (B).
Antibody #2 product nr: HPA041656
Antibody provider: Atlas Antibodies

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human pancreas shows moderate cytoplasmic positivity in exocrine glandular cells.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human liver using Anti-NUBP1 antibody HPA041799.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human testis using Anti-NUBP1 antibody HPA041799.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human kidney using Anti-NUBP1 antibody HPA041799.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human colon using Anti-NUBP1 antibody HPA041799.
Sample type: HUMAN