SAB1400178

NUBP1 antibody from MilliporeSigma / Merck KGaA
CIAO5, NBP1, NBP35
ELISA
Recommended by provider
Immunocytochemistry
Recommended by provider

Antibody data

Product number
SAB1400178
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#SAB1400178, RRID:AB_1854679
Product name
Anti-NUBP1 antibody produced in mouse
Provider product page
MilliporeSigma / Merck KGaA - SAB1400178
Antibody type
Polyclonal
Antigen
NUBP1 (NP_002475.2, a.a. 1-320) full-length human protein.
Description
IgG fraction of antiserum
Reactivity
Human
Antigen sequence
MEEVPHDCPGADSAQAGRGASCQGCPNQRLCASGA
GATPDTAIEEIKEKMKTVKHKILVLSGKGGVGKST
FSAHLAHGLAEDENTQIALLDIDICGPSIPKIMGL
EGEQVHQSGSGWSPVYVEDNLGVMSVGFLLSSPDD
AVIWRGPKKNGMIKQFLRDVDWGEVDYLIVDTPPG
TSDEHLSVVRYLATAHIDGAVIITTPQEVSLQDVR
KEINFCRKVKLPIIGVVENMSGFICPKCKKESQIF
PPTTGGAELMCQDLEVPLLGRVPLDPLIGKNCDKG
QSFFIDAPDSPATLAYRSIIQRIQEFCNLHQSKEE
NLISS (without GST)
Storage
-20C
Provider Type Product Number
- No reagents -