Antibody data

Product number
H00002585-D01P
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00002585-D01P, RRID:AB_10616489
Product name
GALK2 purified MaxPab rabbit polyclonal antibody (D01P)
Provider product page
Abnova Corporation - H00002585-D01P
Antibody type
Polyclonal
Description
Rabbit polyclonal antibody raised against a full-length human GALK2 protein.
Antigen sequence
MATESPATRRVQVAEHPRLLKLKEMFNSKFGSIPK
FYVRAPGRVNIIGEHIDYCGYSVLPMAVEQDVLIA
VEPVKTYALQLANTNPLYPDFSTSANNIQIDKTKP
LWHNYFLCGLKGIQEHFGLSNLTGMNCLVDGNIPP
SSGLSSSSALVCCAGLVTLTVLGRNLSKVELAEIC
AKSERYIGTEGGGMDQSISFLAEEGTAKLIEFSPL
RATDVKLPSGAVFVIANSCVEMNKAATSHFNIRVM
ECRLAAKLLAKYKSLQWDKVLRLEEVQAKLGISLE
EMLLVTEDALHPEPYNPEEICRCLGISLEELRTQI
LSPNTQDVLIFKLYQRAKHVYSEAARVLQFKKICE
EAPENMVQLLGELMNQSHMSCRDMYECSCPELDQL
VDICRKFGAQGSRLTGAGWGGCTVSMVPADKLPSF
LANVHKAYYQRSDGSLAPEKQSLFATKPGGGALVL
LEA
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.