WH0057575M1

PCDH10 antibody from MilliporeSigma / Merck KGaA
KIAA1400, OL-PCDH
ELISA
Recommended by provider

Antibody data

Product number
WH0057575M1
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#WH0057575M1, RRID:AB_1842859
Product name
Monoclonal Anti-PCDH10 antibody produced in mouse
Provider product page
MilliporeSigma / Merck KGaA - WH0057575M1
Antibody type
Monoclonal
Antigen
PCDH10 (NP_065866, a.a. 18-128) partial recombinant protein with GST tag. MW of the GST tag alone is 26 kDa.
Description
purified immunoglobulin
Reactivity
Human
Antigen sequence
SQLHYTVQEEQEHGTFVGNIAEDLGLDITKLSARG
FQTVPNSRTPYLDLNLETGVLYVNEKIDREQICKQ
SPSCVLHLEVFLENPLELFQVEIEVLDINDNPPSF
PEPDL* (without GST)
Isotype
IgG
Storage
-20C
Provider Type Product Number
- No reagents -