Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- Immunoprecipitation [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00027163-M02 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00027163-M02, RRID:AB_10553788
- Product name
- NAAA monoclonal antibody (M02), clone 3F4
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant NAAA.
- Antigen sequence
FNVSLDSVPELRWLPVLRHYDLDLVRAAMAQVIGD
RVPKWVHVLIGKVVLELERFLPQPFTGEIRGMCD- Isotype
- IgG
- Antibody clone number
- 3F4
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of NAAA expression in transfected 293T cell line by NAAA monoclonal antibody (M02), clone 3F4.Lane 1: NAAA transfected lysate(22 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunoprecipitation of NAAA transfected lysate using anti-NAAA monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with NAAA MaxPab rabbit polyclonal antibody.
- Validation comment
- Immunoprecipitation
- Protocol
- Protocol