Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00054880-A01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00054880-A01, RRID:AB_463722
- Product name
- BCOR polyclonal antibody (A01)
- Antibody type
- Polyclonal
- Description
- Mouse polyclonal antibody raised against a partial recombinant BCOR.
- Antigen sequence
RRFRKRPEPSSDYDLSPAKQEPKPFDRLQQLLPAS
QSTQLPCSSSPQETTQSRPMPPEARRLIVNKNAGE
TLLQRAARLGYEEVVLYCLENKICDVNHRD- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Proteomics analysis of Ring1B/Rnf2 interactors identifies a novel complex with the Fbxl10/Jhdm1B histone demethylase and the Bcl6 interacting corepressor.
Sánchez C, Sánchez I, Demmers JA, Rodriguez P, Strouboulis J, Vidal M
Molecular & cellular proteomics : MCP 2007 May;6(5):820-34
Molecular & cellular proteomics : MCP 2007 May;6(5):820-34
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of BCOR expression in transfected 293T cell line by BCOR polyclonal antibody (A01).Lane1:BCOR transfected lysate (Predicted MW: 36.74 KDa).Lane2:Non-transfected lysate.