Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00056832-M01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00056832-M01, RRID:AB_606437
- Product name
- IFNK monoclonal antibody (M01), clone 1B7
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant IFNK.
- Antigen sequence
VHLRRVTWQNLRHLSSMSNSFPVECLRENIAFELP
QEFLQYTQPMKRDIKKAFYEMSLQAFNIFSQHTFK
YWKERHLKQIQIGLDQQAEYLNQCL- Isotype
- IgG
- Antibody clone number
- 1B7
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references High-risk human papillomaviruses repress constitutive kappa interferon transcription via E6 to prevent pathogen recognition receptor and antiviral-gene expression.
Epigenetic silencing of interferon-kappa in human papillomavirus type 16-positive cells.
Reiser J, Hurst J, Voges M, Krauss P, Münch P, Iftner T, Stubenrauch F
Journal of virology 2011 Nov;85(21):11372-80
Journal of virology 2011 Nov;85(21):11372-80
Epigenetic silencing of interferon-kappa in human papillomavirus type 16-positive cells.
Rincon-Orozco B, Halec G, Rosenberger S, Muschik D, Nindl I, Bachmann A, Ritter TM, Dondog B, Ly R, Bosch FX, Zawatzky R, Rösl F
Cancer research 2009 Nov 15;69(22):8718-25
Cancer research 2009 Nov 15;69(22):8718-25
No comments: Submit comment
No validations: Submit validation data