HPA042384

ARSK antibody from Atlas Antibodies
DKFZp313G1735, TSULF
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA042384
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA042384, RRID:AB_10795703
Product name
Anti-ARSK
Provider product page
Atlas Antibodies - HPA042384
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
WSPLSEMHPVDYYSSYTKNCTGRFTKKEIKNIRAF
YYAMCAETDAMLGEIILALHQLDLLQKTIVIYSSD
HGELAMEHRQFYKMSMYEASAHVPLLMMGPGIKAG
LQVSNVVSLVDIYPTMLDIAGIPLPQNLSGYSLLP
LSSETFKNE
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -