H00153642-B01

ARSK antibody from Abnova Corporation
DKFZp313G1735, TSULF

Antibody data

Product number
H00153642-B01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00153642-B01, RRID:AB_1113547
Product name
DKFZp313G1735 MaxPab mouse polyclonal antibody (B01)
Provider product page
Abnova Corporation - H00153642-B01
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human DKFZp313G1735 protein.
Antigen sequence
MLLLWVSVVAALALAVLAPGAGEQRRRAAKAPNVV
LVVSDSFDGRLTFHPGSQVVKLPFINFMKTRGTSF
LNAYTNSPICCPSRAAMWSGLFTHLTESWNNFKGL
DPNYTTWMDVMERHGYRTQKFGKLDYTSGHHSISN
RVEAWTRDVAFLLRQEGRPMVNLIRNRTKVRVMER
DWQNTDKAVNWLRKEAINYTEPFVIYLGLNLPHPY
PSPSSGENFGSSTFHTSLYWLEKVSHDAIKIPKWS
PLSEMHPVDYYSSYTKNCTGRFTKKEIKNIRAFYY
AMCAETDAMLGEIILALHQLDLLQKTIVIYSSDHG
ELAMEHRQFYKMSMYEASAHVPLLMMGPGIKAGLQ
VSNVVSLVDIYPTMLDIAGIPLPQNLSGYSLLPLS
SETFKNEHKVKNLHPPWILSEFHGCNVNASTYMLR
TNHWKYIAYSDGASILPQLFDLSSDPDELTNVAVK
FPEITYSLDQKLHSIINYPKVSASVHQYNKEQFIK
WKQSIGQNYSNVIANLRWHQDWQKEPRKYENAIDQ
WLKTHMNPRAV
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -