Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN311289 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Zinc Finger Protein 121 (ZNF121) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-ZNF121 antibody: synthetic peptide directed towards the middle region of human ZNF121
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat
- Host
- Rabbit
- Antigen sequence
LTKHVRIHTGEKPYECNECGKAYNRFYLLTEHFKT
HTEEK PFECKVCGKS- Epitope
- Middle Region
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Expression profiling and characterization of 4200 genes cloned from primary neuroblastomas: identification of 305 genes differentially expressed between favorable and unfavorable subsets.
Ohira M, Morohashi A, Inuzuka H, Shishikura T, Kawamoto T, Kageyama H, Nakamura Y, Isogai E, Takayasu H, Sakiyama S, Suzuki Y, Sugano S, Goto T, Sato S, Nakagawara A
Oncogene 2003 Aug 21;22(35):5525-36
Oncogene 2003 Aug 21;22(35):5525-36
No comments: Submit comment
No validations: Submit validation data