Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [2]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN502766 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Heparan Sulfate (Glucosamine) 3-O-Sulfotransferase 3B1 (HS3ST3B1) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-HS3ST3B1 antibody: synthetic peptide directed towards the N terminal of human HS3ST3B1
- Description
- Affinity Purified
- Reactivity
- Human, Bovine, Canine
- Host
- Rabbit
- Antigen sequence
AMLCVWLYMFLYSCAGSCAAAPGLLLLGSGSRAAH
DPPAL ATAPDGTPPR- Epitope
- N-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Structural analysis of the sulfotransferase (3-o-sulfotransferase isoform 3) involved in the biosynthesis of an entry receptor for herpes simplex virus 1.
Moon AF, Edavettal SC, Krahn JM, Munoz EM, Negishi M, Linhardt RJ, Liu J, Pedersen LC
The Journal of biological chemistry 2004 Oct 22;279(43):45185-93
The Journal of biological chemistry 2004 Oct 22;279(43):45185-93
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Image(s): Western Blotting
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Host: Rabbit Target Name: HS3ST3B1 Sample Tissue: Human Fetal Heart Antibody Dilution: 1.0 μg/mL