PAB20932

DIPK1A antibody from Abnova Corporation
FAM69A, FLJ23493

Antibody data

Product number
PAB20932
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#PAB20932, RRID:AB_10966080
Product name
FAM69A polyclonal antibody
Provider product page
Abnova Corporation - PAB20932
Antibody type
Polyclonal
Description
Rabbit polyclonal antibody raised against recombinant FAM69A.
Antigen sequence
IICDKYKTGVIDGPACNSLCVTETLYFGKCLSTKP
NNQMYLGIWDNLPGVVKCQMEQALHLDFGTELEPR
KEIVLFDKPTRGTTVQKFKEMVYSLFKAKLGDQGN
LSELVNLILTVADGDKDGQVSLGEAKSAWA
Isotype
IgG
Storage
Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.