HPA017281

DIPK1A antibody from MilliporeSigma / Merck KGaA
FAM69A, FLJ23493
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA017281
Provider
MilliporeSigma / Merck KGaA
Product name
Anti-FAM69A antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA017281
Antibody type
Polyclonal
Antigen
Protein FAM69A recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
IICDKYKTGVIDGPACNSLCVTETLYFGKCLSTKP
NNQMYLGIWDNLPGVVKCQMEQALHLDFGTELEPR
KEIVLFDKPTRGTTVQKFKEMVYSLFKAKLGDQGN
LSELVNLILTVADGDKDGQVSLGEAKSAWA
Storage
-20C