HPA015718

DIPK1A antibody from Atlas Antibodies
FAM69A, FLJ23493

Antibody data

Product number
HPA015718
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA015718, RRID:AB_1848405
Product name
Anti-FAM69A
Provider product page
Atlas Antibodies - HPA015718
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
GYNDKYDLKMVDMRKIVPETNLKELIKDRHCESDL
DCVYGTDCRTSCDQSTMKCTSEVIQPNLAKACQLL
KDYLLRGAPSEIREELEKQLYSCIALKVTANQMEM
EHSLILNNL
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.