HPA042883

antibody from Atlas Antibodies

Targeting: CHMP5 C9orf83, CGI-34, HSPC177, SNF7DC2, Vps60

Antibody data

Submit

Validation data

Product number: HPA042883 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA042883, RRID:AB_2678212
Product name: Anti-CHMP5
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: NRLFGKAKPKAPPPSLTDCIGTVDSRAESIDKKIS RLDAELVKYKDQIKKMREGPAKNMVKQKALRV
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

CHMP5 protein structure - HPA042883 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Independent antibody validation
Main image
Experimental details: Immunohistochemical staining of human colon, kidney, liver and lymph node using Anti-CHMP5 antibody HPA042883 (A) shows similar protein distribution across tissues to independent antibody HPA056437 (B).
Antibody #2 product nr: HPA056437
Antibody provider: Atlas Antibodies

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human kidney shows cytoplasmic positivity in renal tubules.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human kidney using Anti-CHMP5 antibody HPA042883.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human lymph node using Anti-CHMP5 antibody HPA042883.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human liver using Anti-CHMP5 antibody HPA042883.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human colon using Anti-CHMP5 antibody HPA042883.
Sample type: HUMAN