HPA055106

antibody from Atlas Antibodies

Targeting: SLC5A1 D22S675, NAGT, SGLT1

Antibody data

Submit

Validation data

Product number: HPA055106 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA055106, RRID:AB_2682695
Product name: Anti-SLC5A1
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: HEVGGYDAFMEKYMKAIPTIVSDGNTTFQEKCYTP RAD
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

SLC5A1 protein structure - HPA055106 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human duodenum and cerebral cortex tissues using HPA055106 antibody. Corresponding SLC5A1 RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Independent antibody validation
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex, duodenum, endometrium and prostate using Anti-SLC5A1 antibody HPA055106 (A) shows similar protein distribution across tissues to independent antibody HPA051805 (B).
Antibody #2 product nr: HPA051805
Antibody provider: Atlas Antibodies

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human small intestine shows high expression.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human liver shows low expression as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human duodenum shows strong membranous positivity in glandular cells.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex shows no positivity in neurons as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human endometrium shows no positivity in glandular cells as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human prostate shows no positivity in glandular cells as expected.
Sample type: HUMAN