Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN502812 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Coenzyme Q2 Homolog, Prenyltransferase (Yeast) (COQ2) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-COQ2 antibody: synthetic peptide directed towards the middle region of human COQ2
- Description
- Affinity Purified
- Reactivity
- Human, Canine, Zebrafish
- Host
- Rabbit
- Antigen sequence
FSGVMWTLIYDTIYAHQDKRDDVLIGLKSTALRFG
ENTKP WLSGFSVAML- Epitope
- Middle Region
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references COQ2 nephropathy: a newly described inherited mitochondriopathy with primary renal involvement.
Diomedi-Camassei F, Di Giandomenico S, Santorelli FM, Caridi G, Piemonte F, Montini G, Ghiggeri GM, Murer L, Barisoni L, Pastore A, Muda AO, Valente ML, Bertini E, Emma F
Journal of the American Society of Nephrology : JASN 2007 Oct;18(10):2773-80
Journal of the American Society of Nephrology : JASN 2007 Oct;18(10):2773-80
No comments: Submit comment
No validations: Submit validation data