Antibody data

Product number
ABIN502812
Provider
antibodies-online
Product name
anti-Coenzyme Q2 Homolog, Prenyltransferase (Yeast) (COQ2) (Middle Region) antibody
Provider product page
antibodies-online - ABIN502812
Antibody type
Polyclonal
Antigen
The immunogen for anti-COQ2 antibody: synthetic peptide directed towards the middle region of human COQ2
Description
Affinity Purified
Reactivity
Human, Canine, Zebrafish
Host
Rabbit
Antigen sequence
FSGVMWTLIYDTIYAHQDKRDDVLIGLKSTALRFG
ENTKP WLSGFSVAML
Epitope
Middle Region
Vial size
50 μg
Concentration
1mg/mL
Storage
-20°C
Handling
Avoid repeated freeze-thaw cycles.
Provider Type Product Number
- No reagents -